PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G27850.1
Common NameLOC102710882
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 316aa    MW: 35365.8 Da    PI: 4.7866
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G27850.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.2e-09248295653
                   S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
      Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                   +++k qle+Le+++ +++ p+ +++  + + ++L+ + +  WF  +R 
  OB06G27850.1 248 RLKKVQLETLERVYSRTKRPTNTMISSIVQVTNLPRKTIVKWFEDKRE 295
                   57899***************************************9995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000868.19E-7243294No hitNo description
SMARTSM003898.2E-4246304IPR001356Homeobox domain
SuperFamilySSF466891.07E-8246297IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-8248295IPR009057Homeodomain-like
PfamPF000468.9E-7248295IPR001356Homeobox domain
PROSITE profilePS500718.989253300IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MAATVVVVAP LAVVGAPESV RRFGARPLLR RAPRGVSCAL RRRPSKYKNK IQNEEVVAED  60
DIDSAGEDDD DALEALFKQL EEDLKNDDLS VEDDDEGISE EDMARFEQEL AEAIGDIGDV  120
NESAGGSFSG SESYGNDEQT DETERPELKN WQLKRLARAL KIGRRKTSIK NLAGELGLDR  180
TLVIELLRNP PPKLLLMSDS LPEEDPSKPE IKEIEPSPVV HAGDVTETKP HAELPIHVKC  240
AEWSAQKRLK KVQLETLERV YSRTKRPTNT MISSIVQVTN LPRKTIVKWF EDKREQDGVP  300
DHRLAFKRSV PETITS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0713300.0AK071330.1 Oryza sativa Japonica Group cDNA clone:J023089G15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656208.10.0PREDICTED: protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
SwissprotQ8H0V57e-65OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLJ3MFJ10.0J3MFJ1_ORYBR; Uncharacterized protein
STRINGOB06G27850.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107003542
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.11e-61overexpressor of cationic peroxidase 3